PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS67042.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family BBR-BPC
Protein Properties Length: 284aa    MW: 31118.8 Da    PI: 9.9872
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS67042.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind320.45.6e-9822849301
   GAGA_bind   9 rnkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerd..........maflqrdkalaernkalverdnkllalllvenslas 93 
                 rn+gyyep   lk++lglqlm s+a+rd k+    r++ + + ++ +a+++rd          +++  r++++++        ++k+l++l+       
  EPS67042.1   2 RNWGYYEPP--LKSHLGLQLMPSVADRDIKPflsgRDNPI-MVSTTGAFHPRDcvitepplshIDY-VRETWINH--------KDKFLHMLP------- 81 
                 9********..********************999666666.999*********9999988888788.78888888........899*****9....... PP

   GAGA_bind  94 alpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekk 192
                  +p ++   + + s +s+ ++++p+++++a+  ++ e+  ++p ++++  +k++     ++ a++pk+ kakk++k ++++k++ k++   +r+ka kk
  EPS67042.1  82 GNPYSSILAEPSGSHHSMAMVHQPETNNEAAM-PNVEEPVVPP-KTETGPNKKRG-GGGGAPAATPKTAKAKKARKGPPAPKESAKPSV--QRAKAAKK 175
                 34666666677777788888888887776665.4444444444.33333333333.34478999************9999977777666..79****** PP

   GAGA_bind 193 sidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAk 291
                 ++++ +ng+++D++ +P+PvCsCtG+++qCY+WG+GGWqSaCCtttiS++PLP+stkrrgaRiagrKmSqgafkk+LekLa+eGyd++ p+DL+++WAk
  EPS67042.1 176 NVEVCINGIDMDITDIPIPVCSCTGTPQQCYRWGCGGWQSACCTTTISMHPLPMSTKRRGARIAGRKMSQGAFKKVLEKLASEGYDFNSPIDLRTYWAK 274
                 *************************************************************************************************** PP

   GAGA_bind 292 HGtnkfvtir 301
                 HGtnkfv ir
  EPS67042.1 275 HGTNKFVVIR 284
                 ********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.1E-1492284IPR010409GAGA-binding transcriptional activator
PfamPF062174.6E-1062284IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
LRNWGYYEPP LKSHLGLQLM PSVADRDIKP FLSGRDNPIM VSTTGAFHPR DCVITEPPLS  60
HIDYVRETWI NHKDKFLHML PGNPYSSILA EPSGSHHSMA MVHQPETNNE AAMPNVEEPV  120
VPPKTETGPN KKRGGGGGAP AATPKTAKAK KARKGPPAPK ESAKPSVQRA KAAKKNVEVC  180
INGIDMDITD IPIPVCSCTG TPQQCYRWGC GGWQSACCTT TISMHPLPMS TKRRGARIAG  240
RKMSQGAFKK VLEKLASEGY DFNSPIDLRT YWAKHGTNKF VVIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070518.11e-165PREDICTED: protein BASIC PENTACYSTEINE1-like
SwissprotQ9SKD06e-99BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLS8E4340.0S8E434_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_01s0011g06380.t011e-133(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA90612429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.22e-91basic pentacysteine1
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]